SCOP 1.61: Domain d1jfma_: 1jfm A:

Lineage for d1jfma_ (1jfm A:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein NK cell ligand RAE-1 beta [69683] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries)

8. Domain d1jfma_: 1jfm A: [66640]

Details for d1jfma_

PDB Entry: 1jfm, 2.85 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta

SCOP Domain Sequences for d1jfma_:

Sequence; same for both SEQRES and ATOM records:

>d1jfma_ d.19.1.1 (A:) NK cell ligand RAE-1 beta {Mouse (Mus musculus)}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek

Timeline for d1jfma_:

• d1jfma_ first appeared in SCOP 1.59
  
• d1jfma_ appears in SCOP 1.63
  
• d1jfma_ appears in the current release, SCOPe 2.08