Lineage for d1jfja_ (1jfj A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.5: Calmodulin-like [47502] (15 proteins) 
Protein EHCABP [69021] (1 species) Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [69022] (2 PDB entries) 
Domain d1jfja_: 1jfj A: [66638]
Details for d1jfja_
PDB Entry: 1jfj (more details)
PDB Description: nmr solution structure of an ef-hand calcium binding protein from entamoeba histolytica
SCOP Domain Sequences for d1jfja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica)}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
fygsiqgqdlsddkiglkvlyklmdvdgdgkltkeevtsffkkhgiekvaeqvmkadang
dgyitleeflefsl
SCOP Domain Coordinates for d1jfja_:
Click to download the PDB-style file with coordinates for d1jfja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfja_:
- d1jfja_ is new in SCOP 1.59
- d1jfja_ appears in SCOP 1.61
- d1jfja_ appears in the current release, SCOPe 2.08
View in 3D