Lineage for d1jfgb_ (1jfg B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2344488Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2344489Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2344896Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
    automatically mapped to Pfam PF06330
  6. 2344897Protein Trichodiene synthase [69114] (1 species)
  7. 2344898Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)
  8. 2344916Domain d1jfgb_: 1jfg B: [66637]
    complexed with gol, mg, pop

Details for d1jfgb_

PDB Entry: 1jfg (more details), 2.5 Å

PDB Description: trichodiene synthase from fusarium sporotrichioides complexed with diphosphate
PDB Compounds: (B:) trichodiene synthase

SCOPe Domain Sequences for d1jfgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfgb_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOPe Domain Coordinates for d1jfgb_:

Click to download the PDB-style file with coordinates for d1jfgb_.
(The format of our PDB-style files is described here.)

Timeline for d1jfgb_: