SCOPe 2.05: Domain d1jfgb_: 1jfg B:

Lineage for d1jfgb_ (1jfg B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
   automatically mapped to Pfam PF06330

6. Protein Trichodiene synthase [69114] (1 species)

7. Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)

8. Domain d1jfgb_: 1jfg B: [66637]
   complexed with gol, mg, pop

Details for d1jfgb_

PDB Entry: 1jfg, 2.5 Å

PDB Description: trichodiene synthase from fusarium sporotrichioides complexed with diphosphate

PDB Compounds: (B:) trichodiene synthase

SCOPe Domain Sequences for d1jfgb_:

Sequence; same for both SEQRES and ATOM records:

>d1jfgb_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

Timeline for d1jfgb_:

• d1jfgb_ first appeared in SCOP 1.59
  
• d1jfgb_ appears in SCOPe 2.04
  
• d1jfgb_ appears in SCOPe 2.06
  
• d1jfgb_ appears in the current release, SCOPe 2.08