Lineage for d1jfgb_ (1jfg B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648643Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 648644Superfamily a.128.1: Terpenoid synthases [48576] (5 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 648722Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
  6. 648723Protein Trichodiene synthase [69114] (1 species)
  7. 648724Species Fusarium sporotrichioides [TaxId:5514] [69115] (6 PDB entries)
  8. 648730Domain d1jfgb_: 1jfg B: [66637]
    complexed with gol, mo1, mo3, pop

Details for d1jfgb_

PDB Entry: 1jfg (more details), 2.5 Å

PDB Description: trichodiene synthase from fusarium sporotrichioides complexed with diphosphate
PDB Compounds: (B:) trichodiene synthase

SCOP Domain Sequences for d1jfgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfgb_ a.128.1.5 (B:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOP Domain Coordinates for d1jfgb_:

Click to download the PDB-style file with coordinates for d1jfgb_.
(The format of our PDB-style files is described here.)

Timeline for d1jfgb_: