Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Tyrosine phosphatase [52806] (7 species) |
Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (62 PDB entries) |
Domain d1jf7b_: 1jf7 B: [66620] |
PDB Entry: 1jf7 (more details), 2.2 Å
SCOP Domain Sequences for d1jf7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf7b_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), 1B} emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim
Timeline for d1jf7b_: