Lineage for d1jf7b_ (1jf7 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395608Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 395609Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 395648Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 395674Protein Tyrosine phosphatase [52806] (7 species)
  7. 395675Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (58 PDB entries)
  8. 395708Domain d1jf7b_: 1jf7 B: [66620]
    complexed with tbh

Details for d1jf7b_

PDB Entry: 1jf7 (more details), 2.2 Å

PDB Description: human ptp1b catalytic domain complexed with pnu177836

SCOP Domain Sequences for d1jf7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf7b_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

SCOP Domain Coordinates for d1jf7b_:

Click to download the PDB-style file with coordinates for d1jf7b_.
(The format of our PDB-style files is described here.)

Timeline for d1jf7b_: