| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily) |
Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) ![]() |
| Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins) |
| Protein Coxsackievirus b3 (m strain) with its cellular receptor car [69994] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69995] (1 PDB entry) |
| Domain d1jew4_: 1jew 4: [66617] |
PDB Entry: 1jew (more details)
SCOP Domain Sequences for d1jew4_:
Sequence, based on SEQRES records: (download)
>d1jew4_ i.6.1.1 (4:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens)}
gaqvstqktgahetglnasgnsiihytninyykdaasnsanrqdftqdpskftepvkdim
ikslpaln
>d1jew4_ i.6.1.1 (4:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens)}
gaqvstqktgihytninyykdaasnsanrqdftqdpskftepvkdimikslpaln
Timeline for d1jew4_:
View in 3DDomains from other chains: (mouse over for more information) d1jew1_, d1jew2_, d1jew3_, d1jewr_ |