Lineage for d1jew4_ (1jew 4:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 628310Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 628311Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 628312Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 628322Protein Coxsackievirus b3 (m strain) with its cellular receptor car [69994] (1 species)
  7. 628323Species Human (Homo sapiens) [TaxId:9606] [69995] (1 PDB entry)
  8. 628327Domain d1jew4_: 1jew 4: [66617]

Details for d1jew4_

PDB Entry: 1jew (more details)

PDB Description: cryo-em structure of coxsackievirus b3(m strain) with its cellular receptor, coxsackievirus and adenovirus receptor (car).

SCOP Domain Sequences for d1jew4_:

Sequence, based on SEQRES records: (download)

>d1jew4_ i.6.1.1 (4:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens)}
gaqvstqktgahetglnasgnsiihytninyykdaasnsanrqdftqdpskftepvkdim
ikslpaln

Sequence, based on observed residues (ATOM records): (download)

>d1jew4_ i.6.1.1 (4:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens)}
gaqvstqktgihytninyykdaasnsanrqdftqdpskftepvkdimikslpaln

SCOP Domain Coordinates for d1jew4_:

Click to download the PDB-style file with coordinates for d1jew4_.
(The format of our PDB-style files is described here.)

Timeline for d1jew4_: