Lineage for d1jew1_ (1jew 1:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 346691Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 346692Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 346693Family i.6.1.1: Viruses and virus-receptor complexes [58164] (11 proteins)
  6. 346703Protein Coxsackievirus b3 (m strain) with its cellular receptor car [69994] (1 species)
  7. 346704Species Human (Homo sapiens) [TaxId:9606] [69995] (1 PDB entry)
  8. 346705Domain d1jew1_: 1jew 1: [66614]

Details for d1jew1_

PDB Entry: 1jew (more details)

PDB Description: cryo-em structure of coxsackievirus b3(m strain) with its cellular receptor, coxsackievirus and adenovirus receptor (car).

SCOP Domain Sequences for d1jew1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jew1_ i.6.1.1 (1:) Coxsackievirus b3 (m strain) with its cellular receptor car {Human (Homo sapiens)}
rvadtvgtgptnseaipaltaaetghtsqvvpsdtmqtrhvknyhsrsestienflcrsa
cvyfteyensgakryaewvitprqaaqlrrklefftyvrfdleltfvitstqqpsttqnq
daqilthqimyvppggpvpdkvdsyvwqtstnpsvfwtegnapprmsvpflsignaysnf
ydgwsefsrngvygintlnnmgtlyarhvnagstgpikstiriyfkpkhvkawiprpprl
cqyekaknvnfqpsgvtttrqsittmtnt

SCOP Domain Coordinates for d1jew1_:

Click to download the PDB-style file with coordinates for d1jew1_.
(The format of our PDB-style files is described here.)

Timeline for d1jew1_: