Lineage for d1jepb_ (1jep B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187419Fold d.36: Chalcone isomerase [54625] (1 superfamily)
    beta(3)-alpha(2)-beta-alpha(2)-beta3; 2 layers alpha/beta; antiparallel sheet: order 1234567
  4. 2187420Superfamily d.36.1: Chalcone isomerase [54626] (2 families) (S)
    automatically mapped to Pfam PF02431
  5. 2187421Family d.36.1.1: Chalcone isomerase [54627] (1 protein)
  6. 2187422Protein Chalcone isomerase [54628] (1 species)
  7. 2187423Species Alfalfa (Medicago sativa) [TaxId:3879] [54629] (7 PDB entries)
  8. 2187427Domain d1jepb_: 1jep B: [66613]
    complexed with dfl, so4

Details for d1jepb_

PDB Entry: 1jep (more details), 2.1 Å

PDB Description: Chalcone Isomerase Complexed with 4'-hydroxyflavanone
PDB Compounds: (B:) chalcone--flavonone isomerase 1

SCOPe Domain Sequences for d1jepb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jepb_ d.36.1.1 (B:) Chalcone isomerase {Alfalfa (Medicago sativa) [TaxId: 3879]}
sitaitvenleypavvtspvtgksyflggagergltiegnfikftaigvylediavasla
akwkgksseelletldfyrdiisgpfeklirgskirelsgpeysrkvmencvahlksvgt
ygdaeaeamqkfaeafkpvnfppgasvfyrqspdgilglsfspdtsipekeaalienkav
ssavletmigehavspdlkrclaarlpallne

SCOPe Domain Coordinates for d1jepb_:

Click to download the PDB-style file with coordinates for d1jepb_.
(The format of our PDB-style files is described here.)

Timeline for d1jepb_: