| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein) |
| Protein ATP sulfurylase C-terminal domain [64012] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (7 PDB entries) |
| Domain d1jeeb3: 1jee B:390-511 [66609] Other proteins in same PDB: d1jeea1, d1jeea2, d1jeeb1, d1jeeb2 complexed with acy, adx, ca, cd, lco, mg, na, pop, trs |
PDB Entry: 1jee (more details), 2.8 Å
SCOP Domain Sequences for d1jeeb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jeeb3 c.37.1.15 (B:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs
gsgliipnqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff
vf
Timeline for d1jeeb3: