SCOP 1.73: Domain d1jeeb1: 1jee B:2-168

Lineage for d1jeeb1 (1jee B:2-168)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (10 families)

5. Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
   contains extra structures; some similarity to the PK beta-barrel domain

6. Protein ATP sulfurylase N-terminal domain [63802] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)

8. Domain d1jeeb1: 1jee B:2-168 [66607]
   Other proteins in same PDB: d1jeea2, d1jeea3, d1jeeb2, d1jeeb3
   complexed with acy, adx, ca, cd, lco, mg, na, pop, trs

Details for d1jeeb1

PDB Entry: 1jee, 2.8 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with chlorate

PDB Compounds: (B:) sulfate adenylyltransferase

SCOP Domain Sequences for d1jeeb1:

Sequence; same for both SEQRES and ATOM records:

>d1jeeb1 b.122.1.3 (B:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

Timeline for d1jeeb1:

• d1jeeb1 first appeared in SCOP 1.59
  
• d1jeeb1 appears in SCOP 1.71
  
• d1jeeb1 appears in SCOP 1.75
  
• d1jeeb1 appears in the current release, SCOPe 2.08