Lineage for d1jedb1 (1jed B:2-168)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680390Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
  6. 680391Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 680392Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)
  8. 680403Domain d1jedb1: 1jed B:2-168 [66601]
    Other proteins in same PDB: d1jeda2, d1jeda3, d1jedb2, d1jedb3
    complexed with acy, adp, ca, cd, mg, na, trs

Details for d1jedb1

PDB Entry: 1jed (more details), 2.95 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with ADP
PDB Compounds: (B:) sulfate adenylyltransferase

SCOP Domain Sequences for d1jedb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jedb1 b.122.1.3 (B:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1jedb1:

Click to download the PDB-style file with coordinates for d1jedb1.
(The format of our PDB-style files is described here.)

Timeline for d1jedb1: