SCOP 1.73: Domain d1jeda1: 1jed A:2-168

Lineage for d1jeda1 (1jed A:2-168)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (10 families)

5. Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
   contains extra structures; some similarity to the PK beta-barrel domain

6. Protein ATP sulfurylase N-terminal domain [63802] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)

8. Domain d1jeda1: 1jed A:2-168 [66598]
   Other proteins in same PDB: d1jeda2, d1jeda3, d1jedb2, d1jedb3

Details for d1jeda1

PDB Entry: 1jed, 2.95 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with ADP

PDB Compounds: (A:) sulfate adenylyltransferase

SCOP Domain Sequences for d1jeda1:

Sequence; same for both SEQRES and ATOM records:

>d1jeda1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

Timeline for d1jeda1:

• d1jeda1 first appeared in SCOP 1.59
  
• d1jeda1 appears in SCOP 1.71
  
• d1jeda1 appears in SCOP 1.75
  
• d1jeda1 appears in the current release, SCOPe 2.08