Lineage for d1jeca2 (1jec A:169-389)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) 
Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) 
Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein) Protein ATP sulfurylase central domain [63980] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (6 PDB entries) 
Domain d1jeca2: 1jec A:169-389 [66596]
Other proteins in same PDB: d1jeca1, d1jeca3
Details for d1jeca2
PDB Entry: 1jec (more details), 2.5 Å
PDB Description: Crystal Structure of ATP Sulfurylase in complex with thiosulfate
SCOP Domain Sequences for d1jeca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jeca2 c.26.1.5 (A:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp
SCOP Domain Coordinates for d1jeca2:
Click to download the PDB-style file with coordinates for d1jeca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jeca2:
- d1jeca2 is new in SCOP 1.59
- d1jeca2 appears in SCOP 1.61
- d1jeca2 appears in the current release, SCOPe 2.08
View in 3D
