Lineage for d1jebc_ (1jeb C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530658Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 531043Species Human (Homo sapiens), zeta isoform [TaxId:9606] [68937] (1 PDB entry)
  8. 531045Domain d1jebc_: 1jeb C: [66593]
    Other proteins in same PDB: d1jebb_, d1jebd_
    complexed with ace, cmo, hem

Details for d1jebc_

PDB Entry: 1jeb (more details), 2.1 Å

PDB Description: Chimeric Human/Mouse Carbonmonoxy Hemoglobin (Human Zeta2 / Mouse Beta2)

SCOP Domain Sequences for d1jebc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jebc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform}
sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
ahaawdkflsvvssvltekyr

SCOP Domain Coordinates for d1jebc_:

Click to download the PDB-style file with coordinates for d1jebc_.
(The format of our PDB-style files is described here.)

Timeline for d1jebc_: