Lineage for d1jebb_ (1jeb B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474002Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1474576Species Mouse (Mus musculus) [TaxId:10090] [68939] (1 PDB entry)
  8. 1474577Domain d1jebb_: 1jeb B: [66592]
    Other proteins in same PDB: d1jeba_, d1jebc_
    complexed with cmo, hem

Details for d1jebb_

PDB Entry: 1jeb (more details), 2.1 Å

PDB Description: Chimeric Human/Mouse Carbonmonoxy Hemoglobin (Human Zeta2 / Mouse Beta2)
PDB Compounds: (B:) hemoglobin beta-single chain

SCOPe Domain Sequences for d1jebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jebb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Mouse (Mus musculus) [TaxId: 10090]}
vhltdaekaavsglwgkvnadevggealgrllvvypwtqryfdsfgdlssasaimgnakv
kahgkkvitafndglnhldslkgtfaslselhcdklhvdpenfrllgnmivivlghhlgk
dftpaaqaafqkvvagvaaalah

SCOPe Domain Coordinates for d1jebb_:

Click to download the PDB-style file with coordinates for d1jebb_.
(The format of our PDB-style files is described here.)

Timeline for d1jebb_: