Lineage for d1je4a_ (1je4 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175411Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 2175435Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (6 PDB entries)
  8. 2175447Domain d1je4a_: 1je4 A: [66590]
    monomeric variant

Details for d1je4a_

PDB Entry: 1je4 (more details)

PDB Description: solution structure of the monomeric variant of the chemokine mip-1beta
PDB Compounds: (A:) macrophage inflammatory protein 1-beta

SCOPe Domain Sequences for d1je4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je4a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta [TaxId: 9606]}
apmgsdpptaccasytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydleln

SCOPe Domain Coordinates for d1je4a_:

Click to download the PDB-style file with coordinates for d1je4a_.
(The format of our PDB-style files is described here.)

Timeline for d1je4a_: