Lineage for d1je1f_ (1je1 F:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) 
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) 
Family c.56.2.1: Purine and uridine phosphorylases [53168] (3 proteins) 
Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (2 species) 
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries) 
Domain d1je1f_: 1je1 F: [66589]
Details for d1je1f_
PDB Entry: 1je1 (more details), 1.8 Å
PDB Description: 5'-deoxy-5'-methylthioadenosine phosphorylase complex with guanosine and sulfate
SCOP Domain Sequences for d1je1f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1je1f_ c.56.2.1 (F:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus}
pvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiath
giggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylrd
nacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniaveme
catlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts
SCOP Domain Coordinates for d1je1f_:
Click to download the PDB-style file with coordinates for d1je1f_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1je1f_:
- d1je1f_ is new in SCOP 1.59
- d1je1f_ appears in SCOP 1.61
- d1je1f_ appears in the current release, SCOPe 2.08
View in 3D
