SCOPe 2.05: Domain d1je1c_: 1je1 C:

Lineage for d1je1c_ (1je1 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries)

8. Domain d1je1c_: 1je1 C: [66586]
   complexed with gmp, so4

Details for d1je1c_

PDB Entry: 1je1, 1.8 Å

PDB Description: 5'-deoxy-5'-methylthioadenosine phosphorylase complex with guanosine and sulfate

PDB Compounds: (C:) 5'-methylthioadenosine phosphorylase

SCOPe Domain Sequences for d1je1c_:

Sequence; same for both SEQRES and ATOM records:

>d1je1c_ c.56.2.1 (C:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts

Timeline for d1je1c_:

• d1je1c_ first appeared in SCOP 1.59
  
• d1je1c_ appears in SCOPe 2.04
  
• d1je1c_ appears in SCOPe 2.06
  
• d1je1c_ appears in the current release, SCOPe 2.08