Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (4 proteins) |
Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (2 species) |
Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries) |
Domain d1jdvf_: 1jdv F: [66577] complexed with adn, so4 |
PDB Entry: 1jdv (more details), 2 Å
SCOP Domain Sequences for d1jdvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdvf_ c.56.2.1 (F:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus} npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem ecatlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts
Timeline for d1jdvf_: