Lineage for d1jdve_ (1jdv E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125405Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2125421Species Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries)
  8. 2125447Domain d1jdve_: 1jdv E: [66576]
    complexed with adn, so4

Details for d1jdve_

PDB Entry: 1jdv (more details), 2 Å

PDB Description: crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with adenosine and sulfate ion
PDB Compounds: (E:) 5'-methylthioadenosine phosphorylase

SCOPe Domain Sequences for d1jdve_:

Sequence, based on SEQRES records: (download)

>d1jdve_ c.56.2.1 (E:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts

Sequence, based on observed residues (ATOM records): (download)

>d1jdve_ c.56.2.1 (E:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakeleksvmdgakavldtlts

SCOPe Domain Coordinates for d1jdve_:

Click to download the PDB-style file with coordinates for d1jdve_.
(The format of our PDB-style files is described here.)

Timeline for d1jdve_: