Lineage for d1jdtc_ (1jdt C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2140831Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 2140853Species Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries)
  8. 2140883Domain d1jdtc_: 1jdt C: [66568]
    complexed with mta, so4

Details for d1jdtc_

PDB Entry: 1jdt (more details), 2 Å

PDB Description: crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with mta and sulfate ion
PDB Compounds: (C:) 5'-methylthioadenosine phosphorylase

SCOPe Domain Sequences for d1jdtc_:

Sequence, based on SEQRES records: (download)

>d1jdtc_ c.56.2.1 (C:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts

Sequence, based on observed residues (ATOM records): (download)

>d1jdtc_ c.56.2.1 (C:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakleksvmdgakavldtlts

SCOPe Domain Coordinates for d1jdtc_:

Click to download the PDB-style file with coordinates for d1jdtc_.
(The format of our PDB-style files is described here.)

Timeline for d1jdtc_: