SCOP 1.71: Domain d1jdtb_: 1jdt B:

Lineage for d1jdtb_ (1jdt B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)

6. Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69536] (9 PDB entries)

8. Domain d1jdtb_: 1jdt B: [66567]

Details for d1jdtb_

PDB Entry: 1jdt, 2 Å

PDB Description: crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with mta and sulfate ion

SCOP Domain Sequences for d1jdtb_:

Sequence, based on SEQRES records:

>d1jdtb_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakggiwitkeeleksvmdgakavldtlts

Sequence, based on observed residues (ATOM records):

>d1jdtb_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus}
npvhilakkgevaervlvvgdpgrarllstllqnpkltnenrgflvytgkyngetvsiat
hgiggpsiaivleelamlganvfirygttgalvpyinlgeyiivtgasynqgglfyqylr
dnacvastpdfeltnklvtsfskrnlkyyvgnvfssdafyaedeefvkkwssrgniavem
ecatlftlskvkgwksatvlvvsdnlakitkeeleksvmdgakavldtlts

Timeline for d1jdtb_:

• d1jdtb_ first appeared in SCOP 1.59
  
• d1jdtb_ appears in SCOP 1.69
  
• d1jdtb_ appears in SCOP 1.73
  
• d1jdtb_ appears in the current release, SCOPe 2.08