SCOPe 2.06: Domain d1jdqa1: 1jdq A:20-98

Lineage for d1jdqa1 (1jdq A:20-98)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.3: SirA-like [64307] (1 family)

5. Family d.68.3.3: SirA-like [88852] (5 proteins)
   predicted redox protein, regulator of disulfide bond formation

6. Protein Hypothetical protein TM0983 [69751] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69752] (1 PDB entry)

8. Domain d1jdqa1: 1jdq A:20-98 [66559]
   Other proteins in same PDB: d1jdqa2
   structural genomics

Details for d1jdqa1

PDB Entry: 1jdq

PDB Description: solution structure of tm006 protein from thermotoga maritima

PDB Compounds: (A:) hypothetical protein tm0983

SCOPe Domain Sequences for d1jdqa1:

Sequence; same for both SEQRES and ATOM records:

>d1jdqa1 d.68.3.3 (A:20-98) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]}
makyqvtktldvrgevcpvpdvetkralqnmkpgeilevwidypmskeripetvkklghe
vleieevgpsewkiyikvk

Timeline for d1jdqa1:

• d1jdqa1 first appeared in SCOP 1.59, called d1jdqa_
  
• d1jdqa1 was called d1jdqa_ in SCOPe 2.05
  
• d1jdqa1 appears in SCOPe 2.07
  
• d1jdqa1 appears in the current release, SCOPe 2.08