SCOPe 2.05: Domain d1jdqa_: 1jdq A:

Lineage for d1jdqa_ (1jdq A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.3: SirA-like [64307] (1 family)

5. Family d.68.3.3: SirA-like [88852] (5 proteins)
   predicted redox protein, regulator of disulfide bond formation

6. Protein Hypothetical protein TM0983 [69751] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69752] (1 PDB entry)

8. Domain d1jdqa_: 1jdq A: [66559]
   structural genomics

Details for d1jdqa_

PDB Entry: 1jdq

PDB Description: solution structure of tm006 protein from thermotoga maritima

PDB Compounds: (A:) hypothetical protein tm0983

SCOPe Domain Sequences for d1jdqa_:

Sequence; same for both SEQRES and ATOM records:

>d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]}
gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi
dypmskeripetvkklghevleieevgpsewkiyikvk

Timeline for d1jdqa_:

• d1jdqa_ first appeared in SCOP 1.59
  
• d1jdqa_ appears in SCOPe 2.04
  
• d1jdqa_ is called d1jdqa1 in SCOPe 2.06
  
• d1jdqa_ appears in the current release, SCOPe 2.08, called d1jdqa1