Lineage for d1jdqa_ (1jdq A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864751Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 864840Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 864841Family d.68.3.3: SirA-like [88852] (4 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 864845Protein Hypothetical protein TM0983 [69751] (1 species)
  7. 864846Species Thermotoga maritima [TaxId:2336] [69752] (1 PDB entry)
  8. 864847Domain d1jdqa_: 1jdq A: [66559]
    structural genomics

Details for d1jdqa_

PDB Entry: 1jdq (more details)

PDB Description: solution structure of tm006 protein from thermotoga maritima
PDB Compounds: (A:) hypothetical protein tm0983

SCOP Domain Sequences for d1jdqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima [TaxId: 2336]}
gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi
dypmskeripetvkklghevleieevgpsewkiyikvk

SCOP Domain Coordinates for d1jdqa_:

Click to download the PDB-style file with coordinates for d1jdqa_.
(The format of our PDB-style files is described here.)

Timeline for d1jdqa_: