![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.3: SirA-like [64307] (1 family) ![]() |
![]() | Family d.68.3.3: SirA-like [88852] (4 proteins) predicted redox protein, regulator of disulfide bond formation |
![]() | Protein Hypothetical protein TM0983 [69751] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [69752] (1 PDB entry) |
![]() | Domain d1jdqa_: 1jdq A: [66559] structural genomics |
PDB Entry: 1jdq (more details)
SCOP Domain Sequences for d1jdqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdqa_ d.68.3.3 (A:) Hypothetical protein TM0983 {Thermotoga maritima} gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi dypmskeripetvkklghevleieevgpsewkiyikvk
Timeline for d1jdqa_: