Lineage for d1jdid_ (1jdi D:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 401724Fold c.74: AraD-like aldolase/epimerase [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 401725Superfamily c.74.1: AraD-like aldolase/epimerase [53639] (1 family) (S)
  5. 401726Family c.74.1.1: AraD-like aldolase/epimerase [53640] (4 proteins)
    metal (zinc)-ion dependent
  6. 401769Protein L-ribulose-5-phosphate 4-epimerase [69597] (1 species)
  7. 401770Species Escherichia coli [TaxId:562] [69598] (2 PDB entries)
  8. 401780Domain d1jdid_: 1jdi D: [66554]

Details for d1jdid_

PDB Entry: 1jdi (more details), 2.4 Å

PDB Description: crystal structure of l-ribulose-5-phosphate 4-epimerase

SCOP Domain Sequences for d1jdid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdid_ c.74.1.1 (D:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli}
mledlkrqvleanlalpkhnlvtltwgnvsavdrergvfvikpsgvdysimtaddmvvvs
ietgevvegakkpssdtpthrllyqafpsiggivhthsrhatiwaqagqsipatgtthad
yfygtipctrkmtdaeingeyewetgnvivetfekqgidaaqmpgvlvhshgpfawgkna
edavhnaivleevaymgifcrqlapqlpdmqqtllnkhylrkh

SCOP Domain Coordinates for d1jdid_:

Click to download the PDB-style file with coordinates for d1jdid_.
(The format of our PDB-style files is described here.)

Timeline for d1jdid_: