Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.74: Class II aldolase [53638] (1 superfamily) |
Superfamily c.74.1: Class II aldolase [53639] (1 family) |
Family c.74.1.1: Class II aldolase [53640] (2 proteins) |
Protein L-ribulose-5-phosphate 4-epimerase [69597] (1 species) |
Species Escherichia coli [TaxId:562] [69598] (1 PDB entry) |
Domain d1jdic_: 1jdi C: [66553] |
PDB Entry: 1jdi (more details), 2.4 Å
SCOP Domain Sequences for d1jdic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdic_ c.74.1.1 (C:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli} mledlkrqvleanlalpkhnlvtltwgnvsavdrergvfvikpsgvdysimtaddmvvvs ietgevvegakkpssdtpthrllyqafpsiggivhthsrhatiwaqagqsipatgtthad yfygtipctrkmtdaeingeyewetgnvivetfekqgidaaqmpgvlvhshgpfawgkna edavhnaivleevaymgifcrqlapqlpdmqqtllnkhylrkh
Timeline for d1jdic_: