SCOP 1.59: Domain d1jdic_: 1jdi C:

Lineage for d1jdic_ (1jdi C:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.74: Class II aldolase [53638] (1 superfamily)

4. Superfamily c.74.1: Class II aldolase [53639] (1 family)

5. Family c.74.1.1: Class II aldolase [53640] (2 proteins)

6. Protein L-ribulose-5-phosphate 4-epimerase [69597] (1 species)

7. Species Escherichia coli [TaxId:562] [69598] (1 PDB entry)

8. Domain d1jdic_: 1jdi C: [66553]

Details for d1jdic_

PDB Entry: 1jdi, 2.4 Å

PDB Description: crystal structure of l-ribulose-5-phosphate 4-epimerase

SCOP Domain Sequences for d1jdic_:

Sequence; same for both SEQRES and ATOM records:

>d1jdic_ c.74.1.1 (C:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli}
mledlkrqvleanlalpkhnlvtltwgnvsavdrergvfvikpsgvdysimtaddmvvvs
ietgevvegakkpssdtpthrllyqafpsiggivhthsrhatiwaqagqsipatgtthad
yfygtipctrkmtdaeingeyewetgnvivetfekqgidaaqmpgvlvhshgpfawgkna
edavhnaivleevaymgifcrqlapqlpdmqqtllnkhylrkh

Timeline for d1jdic_:

• d1jdic_ is new in SCOP 1.59
  
• d1jdic_ appears in SCOP 1.61
  
• d1jdic_ appears in the current release, SCOPe 2.08