Lineage for d1jdea2 (1jde A:377-504)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176798Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 176799Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
  5. 176800Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 176801Protein Pyruvate phosphate dikinase, central domain [52011] (2 species)
  7. 176802Species Clostridium symbiosum [TaxId:1512] [52012] (6 PDB entries)
  8. 176808Domain d1jdea2: 1jde A:377-504 [66547]
    Other proteins in same PDB: d1jdea1, d1jdea3

Details for d1jdea2

PDB Entry: 1jde (more details), 2.8 Å

PDB Description: k22a mutant of pyruvate, phosphate dikinase

SCOP Domain Sequences for d1jdea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdea2 c.8.1.1 (A:377-504) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum}
lhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspedi
egmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyi
sldgstgk

SCOP Domain Coordinates for d1jdea2:

Click to download the PDB-style file with coordinates for d1jdea2.
(The format of our PDB-style files is described here.)

Timeline for d1jdea2: