Lineage for d1jd4a_ (1jd4 A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 205305Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
  4. 205306Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 205307Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (4 proteins)
  6. 205326Protein BIR2 domain of DIAP1 [69974] (1 species)
  7. 205327Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69975] (3 PDB entries)
  8. 205330Domain d1jd4a_: 1jd4 A: [66542]

Details for d1jd4a_

PDB Entry: 1jd4 (more details), 2.7 Å

PDB Description: Crystal Structure of DIAP1-BIR2

SCOP Domain Sequences for d1jd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd4a_ g.52.1.1 (A:) BIR2 domain of DIAP1 {Fruit fly (Drosophila melanogaster)}
nyfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdwn
dndepweqhalwlsqcrfvklmkgqlyidtvaakpv

SCOP Domain Coordinates for d1jd4a_:

Click to download the PDB-style file with coordinates for d1jd4a_.
(The format of our PDB-style files is described here.)

Timeline for d1jd4a_: