Lineage for d1jcya_ (1jcy A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817768Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 817849Protein 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) [51602] (3 species)
  7. 817850Species Aquifex aeolicus [TaxId:63363] [63922] (18 PDB entries)
  8. 817873Domain d1jcya_: 1jcy A: [66512]

Details for d1jcya_

PDB Entry: 1jcy (more details), 1.9 Å

PDB Description: aquifex aeolicus kdo8p synthase in complex with r5p, pep and cadmium
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOP Domain Sequences for d1jcya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcya_ c.1.10.4 (A:) 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) {Aquifex aeolicus [TaxId: 63363]}
ekflviagpcaieseelllkvgeeikrlsekfkevefvfkssfdkanrssihsfrghgle
ygvkalrkvkeefglkittdiheswqaepvaevadiiqipaflcrqtdlllaaaktgrav
nvkkgqflapwdtknvveklkfggakeiyltergttfgynnlvvdfrslpimkqwakviy
dathsvqlpgglgdksggmrefifpliraavavgcdgvfmethpepekalsdastqlpls
qlegiieaileirevaskyyeti

SCOP Domain Coordinates for d1jcya_:

Click to download the PDB-style file with coordinates for d1jcya_.
(The format of our PDB-style files is described here.)

Timeline for d1jcya_: