Lineage for d1jcrb_ (1jcr B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007408Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2007536Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2007537Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2007552Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 2007554Domain d1jcrb_: 1jcr B: [66507]
    Other proteins in same PDB: d1jcra_
    complexed with acy, fpp, zn

Details for d1jcrb_

PDB Entry: 1jcr (more details), 2 Å

PDB Description: crystal structure of rat protein farnesyltransferase complexed with the non-substrate tetrapeptide inhibitor cvfm and farnesyl diphosphate substrate
PDB Compounds: (B:) protein farnesyltransferase, beta subunit

SCOPe Domain Sequences for d1jcrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcrb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d1jcrb_:

Click to download the PDB-style file with coordinates for d1jcrb_.
(The format of our PDB-style files is described here.)

Timeline for d1jcrb_: