Lineage for d1jcra_ (1jcr A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100719Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 100720Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 100721Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 100724Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (8 PDB entries)
  8. 100726Domain d1jcra_: 1jcr A: [66506]
    Other proteins in same PDB: d1jcrb_

Details for d1jcra_

PDB Entry: 1jcr (more details), 2 Å

PDB Description: crystal structure of rat protein farnesyltransferase complexed with the non-substrate tetrapeptide inhibitor cvfm and farnesyl diphosphate substrate

SCOP Domain Sequences for d1jcra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcra_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsresdipasv

SCOP Domain Coordinates for d1jcra_:

Click to download the PDB-style file with coordinates for d1jcra_.
(The format of our PDB-style files is described here.)

Timeline for d1jcra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jcrb_