Lineage for d1jcqb_ (1jcq B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774411Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 774536Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 774537Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 774538Species Human (Homo sapiens) [TaxId:9606] [69090] (19 PDB entries)
    Uniprot P49356
  8. 774548Domain d1jcqb_: 1jcq B: [66505]
    Other proteins in same PDB: d1jcqa_
    complexed with 739, acy, fpp, suc, zn; mutant

Details for d1jcqb_

PDB Entry: 1jcq (more details), 2.3 Å

PDB Description: crystal structure of human protein farnesyltransferase complexed with farnesyl diphosphate and the peptidomimetic inhibitor l-739,750
PDB Compounds: (B:) protein farnesyltransferase, beta subunit

SCOP Domain Sequences for d1jcqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

SCOP Domain Coordinates for d1jcqb_:

Click to download the PDB-style file with coordinates for d1jcqb_.
(The format of our PDB-style files is described here.)

Timeline for d1jcqb_: