![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array |
![]() | Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) ![]() |
![]() | Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
![]() | Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69090] (3 PDB entries) |
![]() | Domain d1jcqb_: 1jcq B: [66505] Other proteins in same PDB: d1jcqa_ complexed with 739, acy, fpp, suc, zn; mutant |
PDB Entry: 1jcq (more details), 2.3 Å
SCOP Domain Sequences for d1jcqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens)} sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe
Timeline for d1jcqb_: