Lineage for d1jcqa_ (1jcq A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922275Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 922276Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 922277Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 922278Species Human (Homo sapiens) [TaxId:9606] [69093] (20 PDB entries)
    Uniprot P49354
  8. 922289Domain d1jcqa_: 1jcq A: [66504]
    Other proteins in same PDB: d1jcqb_
    complexed with 739, acy, fpp, suc, zn

Details for d1jcqa_

PDB Entry: 1jcq (more details), 2.3 Å

PDB Description: crystal structure of human protein farnesyltransferase complexed with farnesyl diphosphate and the peptidomimetic inhibitor l-739,750
PDB Compounds: (A:) protein farnesyltransferase, alpha subunit

SCOPe Domain Sequences for d1jcqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcqa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskh

SCOPe Domain Coordinates for d1jcqa_:

Click to download the PDB-style file with coordinates for d1jcqa_.
(The format of our PDB-style files is described here.)

Timeline for d1jcqa_: