Lineage for d1jcjb1 (1jcj B:1-250)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097020Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 2097027Species Escherichia coli [TaxId:562] [69395] (4 PDB entries)
    Uniprot P00882
  8. 2097033Domain d1jcjb1: 1jcj B:1-250 [66500]
    Other proteins in same PDB: d1jcja2, d1jcjb2
    complexed with hpd

Details for d1jcjb1

PDB Entry: 1jcj (more details), 1.1 Å

PDB Description: observation of covalent intermediates in an enzyme mechanism at atomic resolution
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d1jcjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcjb1 c.1.10.1 (B:1-250) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]}
mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
sarimmevirdmgvektvgflpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
lasllkalgh

SCOPe Domain Coordinates for d1jcjb1:

Click to download the PDB-style file with coordinates for d1jcjb1.
(The format of our PDB-style files is described here.)

Timeline for d1jcjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jcjb2