Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species) |
Species Escherichia coli [TaxId:562] [69395] (4 PDB entries) Uniprot P00882 |
Domain d1jcjb1: 1jcj B:1-250 [66500] Other proteins in same PDB: d1jcja2, d1jcjb2 complexed with hpd |
PDB Entry: 1jcj (more details), 1.1 Å
SCOPe Domain Sequences for d1jcjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcjb1 c.1.10.1 (B:1-250) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe sarimmevirdmgvektvgflpaggvrtaedaqkylaiadelfgadwadarhyrfgassl lasllkalgh
Timeline for d1jcjb1: