Lineage for d1jcja_ (1jcj A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117047Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 117048Family c.1.10.1: Class I aldolase [51570] (7 proteins)
  6. 117049Protein Deoxyribose-phosphate aldolase DeoC [69394] (1 species)
  7. 117050Species Escherichia coli [TaxId:562] [69395] (2 PDB entries)
  8. 117053Domain d1jcja_: 1jcj A: [66499]

Details for d1jcja_

PDB Entry: 1jcj (more details), 1.1 Å

PDB Description: observation of covalent intermediates in an enzyme mechanism at atomic resolution

SCOP Domain Sequences for d1jcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcja_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli}
hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
esarimmevirdmgvektvgflpaggvrtaedaqkylaiadelfgadwadarhyrfgass
llasllkalghg

SCOP Domain Coordinates for d1jcja_:

Click to download the PDB-style file with coordinates for d1jcja_.
(The format of our PDB-style files is described here.)

Timeline for d1jcja_: