Lineage for d1jchc2 (1jch C:84-315)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115896Fold b.110: Colicin E3 translocation domain [69368] (1 superfamily)
  4. 115897Superfamily b.110.1: Colicin E3 translocation domain [69369] (1 family) (S)
  5. 115898Family b.110.1.1: Colicin E3 translocation domain [69370] (1 protein)
  6. 115899Protein Colicin E3 translocation domain [69371] (1 species)
  7. 115900Species Escherichia coli [TaxId:562] [69372] (1 PDB entry)
  8. 115902Domain d1jchc2: 1jch C:84-315 [66496]
    Other proteins in same PDB: d1jcha1, d1jcha3, d1jchb_, d1jchc1, d1jchc3, d1jchd_

Details for d1jchc2

PDB Entry: 1jch (more details), 3.02 Å

PDB Description: Crystal Structure of Colicin E3 in Complex with its Immunity Protein

SCOP Domain Sequences for d1jchc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jchc2 b.110.1.1 (C:84-315) Colicin E3 translocation domain {Escherichia coli}
vaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlpsq
iakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsgvp
msvpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpafgtq
ggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathp

SCOP Domain Coordinates for d1jchc2:

Click to download the PDB-style file with coordinates for d1jchc2.
(The format of our PDB-style files is described here.)

Timeline for d1jchc2: