Lineage for d1jchc2 (1jch C:84-315)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075111Fold b.110: Cloacin translocation domain [69368] (1 superfamily)
    complex fold made of several coiled beta-sheets
  4. 2075112Superfamily b.110.1: Cloacin translocation domain [69369] (1 family) (S)
    automatically mapped to Pfam PF03515
  5. 2075113Family b.110.1.1: Cloacin translocation domain [69370] (2 protein domains)
    Pfam PF03515
  6. 2075117Protein Colicin E3 N-terminal domain [69371] (1 species)
  7. 2075118Species Escherichia coli [TaxId:562] [69372] (2 PDB entries)
  8. 2075122Domain d1jchc2: 1jch C:84-315 [66496]
    Other proteins in same PDB: d1jcha1, d1jcha3, d1jchb_, d1jchc1, d1jchc3, d1jchd_
    protein/RNA complex; complexed with cit, gol

Details for d1jchc2

PDB Entry: 1jch (more details), 3.02 Å

PDB Description: Crystal Structure of Colicin E3 in Complex with its Immunity Protein
PDB Compounds: (C:) Colicin E3

SCOPe Domain Sequences for d1jchc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jchc2 b.110.1.1 (C:84-315) Colicin E3 N-terminal domain {Escherichia coli [TaxId: 562]}
vaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlpsq
iakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsgvp
msvpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpafgtq
ggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathp

SCOPe Domain Coordinates for d1jchc2:

Click to download the PDB-style file with coordinates for d1jchc2.
(The format of our PDB-style files is described here.)

Timeline for d1jchc2: