SCOP 1.69: Domain d1jchc1: 1jch C:455-551

Lineage for d1jchc1 (1jch C:455-551)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.101: Ribonuclease domain of colicin E3 [63839] (1 superfamily)
   twisted meander beta-sheet of 6 strands

4. Superfamily b.101.1: Ribonuclease domain of colicin E3 [63840] (1 family)

5. Family b.101.1.1: Ribonuclease domain of colicin E3 [63841] (1 protein)

6. Protein Ribonuclease domain of colicin E3 [63842] (1 species)

7. Species Escherichia coli [TaxId:562] [63843] (2 PDB entries)

8. Domain d1jchc1: 1jch C:455-551 [66495]
   Other proteins in same PDB: d1jcha2, d1jcha3, d1jchb_, d1jchc2, d1jchc3, d1jchd_

Details for d1jchc1

PDB Entry: 1jch, 3.02 Å

PDB Description: Crystal Structure of Colicin E3 in Complex with its Immunity Protein

SCOP Domain Sequences for d1jchc1:

Sequence; same for both SEQRES and ATOM records:

>d1jchc1 b.101.1.1 (C:455-551) Ribonuclease domain of colicin E3 {Escherichia coli}
kgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkgrkiyewdsqhg
elegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl

Timeline for d1jchc1:

• d1jchc1 first appeared in SCOP 1.59
  
• d1jchc1 appears in SCOP 1.67
  
• d1jchc1 appears in SCOP 1.71
  
• d1jchc1 appears in the current release, SCOPe 2.08