Class b: All beta proteins [48724] (144 folds) |
Fold b.101: Ribonuclease domain of colicin E3 [63839] (1 superfamily) twisted meander beta-sheet of 6 strands |
Superfamily b.101.1: Ribonuclease domain of colicin E3 [63840] (1 family) |
Family b.101.1.1: Ribonuclease domain of colicin E3 [63841] (1 protein) |
Protein Ribonuclease domain of colicin E3 [63842] (1 species) |
Species Escherichia coli [TaxId:562] [63843] (2 PDB entries) |
Domain d1jchc1: 1jch C:455-551 [66495] Other proteins in same PDB: d1jcha2, d1jcha3, d1jchb_, d1jchc2, d1jchc3, d1jchd_ |
PDB Entry: 1jch (more details), 3.02 Å
SCOP Domain Sequences for d1jchc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jchc1 b.101.1.1 (C:455-551) Ribonuclease domain of colicin E3 {Escherichia coli} kgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkgrkiyewdsqhg elegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl
Timeline for d1jchc1: