Lineage for d1jbja2 (1jbj A:1-100)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 protein domains)
  6. 104732Protein CD3 epsilon chain ectodomain fragment [69162] (1 species)
  7. 104733Species Mouse (Mus musculus) [TaxId:10090] [69163] (1 PDB entry)
  8. 104734Domain d1jbja2: 1jbj A:1-100 [66483]
    Other proteins in same PDB: d1jbja1

Details for d1jbja2

PDB Entry: 1jbj (more details)

PDB Description: CD3 Epsilon and gamma Ectodomain Fragment Complex in Single-Chain Construct

SCOP Domain Sequences for d1jbja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus)}
ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
vcytpasnkntylylkarvgsaddakkdaakkddakkdda

SCOP Domain Coordinates for d1jbja2:

Click to download the PDB-style file with coordinates for d1jbja2.
(The format of our PDB-style files is described here.)

Timeline for d1jbja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jbja1