SCOPe 2.08: Domain d1jbja1: 1jbj A:101-186

Lineage for d1jbja1 (1jbj A:101-186)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein CD3 gamma chain ectodomain fragment [69160] (2 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Mouse (Mus musculus) [TaxId:10090] [69161] (1 PDB entry)

8. Domain d1jbja1: 1jbj A:101-186 [66482]
   Other proteins in same PDB: d1jbja2
   a single-chain construct with epsilon chain domain, includes part of the linker

Details for d1jbja1

PDB Entry: 1jbj

PDB Description: cd3 epsilon and gamma ectodomain fragment complex in single-chain construct

PDB Compounds: (A:) CD3 Epsilon and gamma Ectodomain Fragment Complex

SCOPe Domain Sequences for d1jbja1:

Sequence; same for both SEQRES and ATOM records:

>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]}
kkdgsqtnkaknlvqvdgsrgdgsvlltcgltdktikwlkdgsiisplnatkntwnlgnn
akdprgtyqcqgaketsnplqvyyrm

Timeline for d1jbja1:

• d1jbja1 first appeared in SCOP 1.59
  
• d1jbja1 appears in SCOPe 2.07