Lineage for d1jbia_ (1jbi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006430Fold d.209: LCCL domain [69847] (1 superfamily)
    unusual fold
  4. 3006431Superfamily d.209.1: LCCL domain [69848] (1 family) (S)
    automatically mapped to Pfam PF03815
  5. 3006432Family d.209.1.1: LCCL domain [69849] (1 protein)
  6. 3006433Protein Cochlin [69850] (1 species)
  7. 3006434Species Human (Homo sapiens) [TaxId:9606] [69851] (1 PDB entry)
  8. 3006435Domain d1jbia_: 1jbi A: [66481]

Details for d1jbia_

PDB Entry: 1jbi (more details)

PDB Description: nmr structure of the lccl domain
PDB Compounds: (A:) cochlin

SCOPe Domain Sequences for d1jbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbia_ d.209.1.1 (A:) Cochlin {Human (Homo sapiens) [TaxId: 9606]}
tapiaitcftrgldirkekadvlcpggcpleefsvygnivyasvssicgaavhrgvisns
ggpvrvyslpgrenyssvdangiqsqmlsrwsasftvtle

SCOPe Domain Coordinates for d1jbia_:

Click to download the PDB-style file with coordinates for d1jbia_.
(The format of our PDB-style files is described here.)

Timeline for d1jbia_: