Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.209: LCCL domain [69847] (1 superfamily) unusual fold |
Superfamily d.209.1: LCCL domain [69848] (1 family) automatically mapped to Pfam PF03815 |
Family d.209.1.1: LCCL domain [69849] (1 protein) |
Protein Cochlin [69850] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69851] (1 PDB entry) |
Domain d1jbia_: 1jbi A: [66481] |
PDB Entry: 1jbi (more details)
SCOPe Domain Sequences for d1jbia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbia_ d.209.1.1 (A:) Cochlin {Human (Homo sapiens) [TaxId: 9606]} tapiaitcftrgldirkekadvlcpggcpleefsvygnivyasvssicgaavhrgvisns ggpvrvyslpgrenyssvdangiqsqmlsrwsasftvtle
Timeline for d1jbia_: