SCOPe 2.05: Domain d1jaya_: 1jay A:

Lineage for d1jaya_ (1jay A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Coenzyme F420H2:NADP+ oxidoreductase (FNO) [69421] (1 species)
   lacks all but the first helix of the C-terminal all-alpha domain

7. Species Archaeoglobus fulgidus [TaxId:2234] [69422] (2 PDB entries)

8. Domain d1jaya_: 1jay A: [66478]
   complexed with f42, na, nap

Details for d1jaya_

PDB Entry: 1jay, 1.65 Å

PDB Description: Structure of Coenzyme F420H2:NADP+ Oxidoreductase (FNO) with its substrates bound

PDB Compounds: (A:) Coenzyme F420H2:NADP+ Oxidoreductase (FNO)

SCOPe Domain Sequences for d1jaya_:

Sequence; same for both SEQRES and ATOM records:

>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeoglobus fulgidus [TaxId: 2234]}
mrvallggtgnlgkglalrlatlgheivvgsrreekaeakaaeyrriagdasitgmkned
aaeacdiavltipwehaidtardlknilrekivvsplvpvsrgakgftyssersaaeiva
evlesekvvsalhtipaarfanldekfdwdvpvcgdddeskkvvmsliseidglrpldag
plsnsrlvesltplilnimrfngmgelgikfl

Timeline for d1jaya_:

• d1jaya_ first appeared in SCOP 1.59
  
• d1jaya_ appears in SCOPe 2.04
  
• d1jaya_ appears in SCOPe 2.06
  
• d1jaya_ appears in the current release, SCOPe 2.08