Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Coenzyme F420H2:NADP+ oxidoreductase (FNO) [69421] (1 species) lacks all but the first helix of the C-terminal all-alpha domain |
Species Archaeoglobus fulgidus [TaxId:2234] [69422] (2 PDB entries) |
Domain d1jaya_: 1jay A: [66478] complexed with f42, na, nap |
PDB Entry: 1jay (more details), 1.65 Å
SCOPe Domain Sequences for d1jaya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeoglobus fulgidus [TaxId: 2234]} mrvallggtgnlgkglalrlatlgheivvgsrreekaeakaaeyrriagdasitgmkned aaeacdiavltipwehaidtardlknilrekivvsplvpvsrgakgftyssersaaeiva evlesekvvsalhtipaarfanldekfdwdvpvcgdddeskkvvmsliseidglrpldag plsnsrlvesltplilnimrfngmgelgikfl
Timeline for d1jaya_: