Lineage for d1jaka2 (1jak A:8-150)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) 
Superfamily d.92.2: beta-N-acetylhexosaminidase domain [55545] (1 family) 
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (2 proteins) Protein beta-N-acetylhexosaminidase, N-terminal domain [64343] (1 species) Species Streptomyces plicatus [TaxId:1922] [64344] (3 PDB entries) 
Domain d1jaka2: 1jak A:8-150 [66473]
Other proteins in same PDB: d1jaka1
Details for d1jaka2
PDB Entry: 1jak (more details), 1.75 Å
PDB Description: Streptomyces plicatus beta-N-acetylhexosaminidase in Complex with (2R,3R,4S,5R)-2-acetamido-3,4-dihydroxy-5-hydroxymethyl-piperidinium chloride (IFG)
SCOP Domain Sequences for d1jaka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jaka2 d.92.2.1 (A:8-150) beta-N-acetylhexosaminidase, N-terminal domain {Streptomyces plicatus}
drkapvrptpldrvipapasvdpggapyritrgthirvddsrearrvgdyladllrpatg
yrlpvtahghggirlrlaggpygdegyrldsgpagvtitarkaaglfhgvqtlrqllppa
vekdsaqpgpwlvaggtiedtpr
SCOP Domain Coordinates for d1jaka2:
Click to download the PDB-style file with coordinates for d1jaka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jaka2:
- d1jaka2 first appeared in SCOP 1.59
- d1jaka2 appears in SCOP 1.63
- d1jaka2 appears in the current release, SCOPe 2.08
View in 3D
