Lineage for d1j9oa_ (1j9o A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins) 
Protein Lymphotactin [69632] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69633] (2 PDB entries) 
Domain d1j9oa_: 1j9o A: [66460]
Details for d1j9oa_
PDB Entry: 1j9o (more details)
PDB Description: solution structure of human lymphotactin
SCOP Domain Sequences for d1j9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9oa_ d.9.1.1 (A:) Lymphotactin {Human (Homo sapiens)}
vgsevsdkrtcvslttqrlpvsriktytitegslravifitkrglkvcadpqatwvrdvv
rsmdrksntrnnmiqtkptgtqqstntavtltg
SCOP Domain Coordinates for d1j9oa_:
Click to download the PDB-style file with coordinates for d1j9oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j9oa_:
- d1j9oa_ first appeared in SCOP 1.59
- d1j9oa_ appears in SCOP 1.63
- d1j9oa_ appears in the current release, SCOPe 2.08
View in 3D