Lineage for d1j90b_ (1j90 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109418Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 2109419Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 2109437Domain d1j90b_: 1j90 B: [66449]
    CASP4
    complexed with dcz, so4

Details for d1j90b_

PDB Entry: 1j90 (more details), 2.56 Å

PDB Description: Crystal Structure of Drosophila Deoxyribonucleoside Kinase
PDB Compounds: (B:) Deoxyribonucleoside kinase

SCOPe Domain Sequences for d1j90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j90b_ c.37.1.1 (B:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwa
mpfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewyk
fieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwlihqrrp
qsckvlvldad

SCOPe Domain Coordinates for d1j90b_:

Click to download the PDB-style file with coordinates for d1j90b_.
(The format of our PDB-style files is described here.)

Timeline for d1j90b_: